TRA2B anticorps

N° du produit ABIN629994

Cet anticorps anti-TRA2B est un anticorps Lapin Polyclonal détectant TRA2B dans WB et IHC. Adapté pour Humain, Souris, Chien et Rat.

Aperçu rapide pour TRA2B anticorps (ABIN629994)

Antigène: TRA2B (Transformer 2 beta Homolog (TRA2B))

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRA2B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-TRA2B anticorps

Purification: Purified

Immunogène: SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS10 Blocking Peptide, (ABIN939022), is also available for use as a blocking control in assays to test for specificity of this SFRS10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRA2B

Antigène: TRA2B (Transformer 2 beta Homolog (TRA2B))

Autre désignation: SFRS10

Sujet: SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.

Poids moléculaire: 32 kDa (MW of target protein)