SNRPF anticorps (N-Term)

N° du produit ABIN629996

L’anticorps Lapin Polyclonal anti-SNRPF a été validé pour WB et IHC. Il convient pour détecter SNRPF dans des échantillons de Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour SNRPF anticorps (N-Term) (ABIN629996)

Antigène: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRPF est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SNRPF anticorps

Épitope: N-Term

Specificité: SNRPF antibody was raised against the N terminal of SNRPF

Purification: Purified

Immunogène: SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY

Information d'application

Indications d'application: WB: 0.31 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRPF Blocking Peptide, (ABIN5616328), is also available for use as a blocking control in assays to test for specificity of this SNRPF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRPF

Antigène: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Autre désignation: SNRPF

Sujet: SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.

Poids moléculaire: 9 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization