SFRS8 anticorps (N-Term)

N° du produit ABIN629997

Cet anticorps anti-SFRS8 est un anticorps Lapin Polyclonal détectant SFRS8 dans WB. Adapté pour Humain.

Aperçu rapide pour SFRS8 anticorps (N-Term) (ABIN629997)

Antigène: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRS8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SFRS8 anticorps

Épitope: N-Term

Specificité: SFRS8 antibody was raised against the N terminal of SFRS8

Purification: Purified

Immunogène: SFRS8 antibody was raised using the N terminal of SFRS8 corresponding to a region with amino acids MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDER

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS8 Blocking Peptide, (ABIN5616106), is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRS8

Antigène: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Autre désignation: SFRS8

Sujet: SFRS8 is a human homolog of Drosophila splicing regulatory protein.

Poids moléculaire: 105 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization