APOBEC2 anticorps (N-Term)
-
- Antigène Voir toutes APOBEC2 Anticorps
- APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp APOBEC2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- ApoBEC2 antibody was raised against the N terminal of APOBEC2
- Purification
- Purified
- Immunogène
- ApoBEC2 antibody was raised using the N terminal of APOBEC2 corresponding to a region with amino acids VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
- Top Product
- Discover our top product APOBEC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ApoBEC2 Blocking Peptide, catalog no. 33R-9438, is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))
- Autre désignation
- ApoBEC2 (APOBEC2 Produits)
- Sujet
- APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.
- Poids moléculaire
- 25 kDa (MW of target protein)
-