RPL8 anticorps (C-Term)

N° du produit ABIN630002

Détail du produit anti-RPL8 anticorps

Antigène: RPL8 (Ribosomal Protein L8 (RPL8))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL8 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RPL8 antibody was raised against the C terminal of RPL8

Purification: Purified

Immunogène: RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM

Information d'application

Indications d'application: WB: 0.3125 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL8 Blocking Peptide, catalog no. 33R-4496, is also available for use as a blocking control in assays to test for specificity of this RPL8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL8

Antigène: RPL8 (Ribosomal Protein L8 (RPL8))

Autre désignation: RPL8 (RPL8 Produits)

Synonymes: anticorps L8, anticorps zgc:73105, anticorps zgc:77641, anticorps CG1263, anticorps Dmel\\CG1263, anticorps M(3)62F, anticorps M(3)LS2, anticorps Rp L8, anticorps anon-EST:Posey5, anticorps rpL8, anticorps RPL8, anticorps ribosomal protein L8, anticorps ribosomal protein L8 S homeolog, anticorps Ribosomal protein L8, anticorps microRNA 6850, anticorps RPL8, anticorps Rpl8, anticorps rpl8.S, anticorps rpl8, anticorps RpL8, anticorps MIR6850

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL8 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Regulation of Cell Size