PPIE anticorps

N° du produit ABIN630007

Cet anticorps Lapin Polyclonal détecte spécifiquement PPIE dans WB. Il présente une réactivité envers Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio) et Drosophila melanogaster.

Aperçu rapide pour PPIE anticorps (ABIN630007)

Antigène: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio), Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPIE est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PPIE anticorps

Purification: Purified

Immunogène: PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPIE Blocking Peptide, (ABIN5615495), is also available for use as a blocking control in assays to test for specificity of this PPIE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPIE

Antigène: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Autre désignation: PPIE

Sujet: PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain.

Poids moléculaire: 26 kDa (MW of target protein)