PPIE anticorps

N° du produit ABIN630007

Détail du produit anti-PPIE anticorps

Antigène: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio), Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPIE est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPIE Blocking Peptide, catalog no. 33R-7968, is also available for use as a blocking control in assays to test for specificity of this PPIE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPIE

Antigène: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Autre désignation: PPIE (PPIE Produits)

Synonymes: anticorps zgc:112471, anticorps CG4886, anticorps CYP33, anticorps Cyp33, anticorps Dcyp33, anticorps Dmel\\CG4886, anticorps PPIE, anticorps cyp-33, anticorps cyp33, anticorps cype, anticorps CYP-33, anticorps 2010010D16Rik, anticorps Ab1-210, anticorps peptidylprolyl isomerase E (cyclophilin E), anticorps cyclophilin-33, anticorps peptidylprolyl isomerase E, anticorps peptidylprolyl isomerase E (cyclophilin E) L homeolog, anticorps ppie, anticorps cyp33, anticorps PPIE, anticorps ppie.L, anticorps Ppie

Sujet: PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain.

Poids moléculaire: 26 kDa (MW of target protein)