EXOSC6 anticorps (N-Term)

N° du produit ABIN630012

Cet anticorps anti-EXOSC6 est un anticorps Lapin Polyclonal détectant EXOSC6 dans WB et IHC. Adapté pour Humain et Chien.

Aperçu rapide pour EXOSC6 anticorps (N-Term) (ABIN630012)

Antigène: EXOSC6 (Exosome Component 6 (EXOSC6))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXOSC6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-EXOSC6 anticorps

Épitope: N-Term

Specificité: EXOSC6 antibody was raised against the N terminal of EXOSC6

Purification: Purified

Immunogène: EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOSC6 Blocking Peptide, (ABIN5613437), is also available for use as a blocking control in assays to test for specificity of this EXOSC6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXOSC6

Antigène: EXOSC6 (Exosome Component 6 (EXOSC6))

Autre désignation: EXOSC6

Sujet: EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response