RPLP0 anticorps (Middle Region)

N° du produit ABIN630015

Cet anticorps anti-RPLP0 est un anticorps Lapin Polyclonal détectant RPLP0 dans WB. Adapté pour Humain et Chien.

Aperçu rapide pour RPLP0 anticorps (Middle Region) (ABIN630015)

Antigène: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPLP0 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPLP0 anticorps

Épitope: Middle Region

Specificité: RPLP0 antibody was raised against the middle region of RPLP0

Purification: Purified

Immunogène: RPLP0 antibody was raised using the middle region of RPLP0 corresponding to a region with amino acids PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPLP0 Blocking Peptide, (ABIN5615942), is also available for use as a blocking control in assays to test for specificity of this RPLP0 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPLP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPLP0

Antigène: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Autre désignation: RPLP0

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2.

Poids moléculaire: 35 kDa (MW of target protein)