PRP6/ANT-1 anticorps

N° du produit ABIN630021

Cet anticorps anti-PRP6/ANT-1 est un anticorps Lapin Polyclonal détectant PRP6/ANT-1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour PRP6/ANT-1 anticorps (ABIN630021)

Antigène: PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRP6/ANT-1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PRP6/ANT-1 anticorps

Purification: Purified

Immunogène: PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRPF6 Blocking Peptide, (ABIN938516), is also available for use as a blocking control in assays to test for specificity of this PRPF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRP6/ANT-1

Antigène: PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))

Autre désignation: PRPF6

Sujet: PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Poids moléculaire: 104 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Proton Transport, Dicarboxylic Acid Transport