MTHFSD anticorps (N-Term)

N° du produit ABIN630026

L’anticorps Lapin Polyclonal anti-MTHFSD a été validé pour WB et IHC. Il convient pour détecter MTHFSD dans des échantillons de Humain, Souris et Chien.

Aperçu rapide pour MTHFSD anticorps (N-Term) (ABIN630026)

Antigène: MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTHFSD est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-MTHFSD anticorps

Épitope: N-Term

Specificité: MTHFSD antibody was raised against the N terminal of MTHFSD

Purification: Purified

Immunogène: MTHFSD antibody was raised using the N terminal of MTHFSD corresponding to a region with amino acids EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL

Information d'application

Indications d'application: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTHFSD Blocking Peptide, (ABIN938184), is also available for use as a blocking control in assays to test for specificity of this MTHFSD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFSD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTHFSD

Antigène: MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))

Autre désignation: MTHFSD

Sujet: The function remains unknows.

Poids moléculaire: 41 kDa (MW of target protein)