HNRPLL anticorps (N-Term)

N° du produit ABIN630031

Détail du produit anti-HNRPLL anticorps

Antigène: HNRPLL (Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRPLL est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: HNRPLL antibody was raised against the N terminal of HNRPLL

Purification: Purified

Immunogène: HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPLL Blocking Peptide, catalog no. 33R-8037, is also available for use as a blocking control in assays to test for specificity of this HNRPLL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPLL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRPLL

Antigène: HNRPLL (Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL))

Autre désignation: HNRPLL (HNRPLL Produits)

Synonymes: anticorps HNRPLL, anticorps SRRF, anticorps 2510028H02Rik, anticorps 2810036L13Rik, anticorps AI256697, anticorps AI852082, anticorps Hnrpll, anticorps RGD1305861, anticorps srrf, anticorps heterogeneous nuclear ribonucleoprotein L like, anticorps heterogeneous nuclear ribonucleoprotein L-like, anticorps Heterogeneous nuclear ribonucleoprotein L-like, anticorps heterogeneous nuclear ribonucleoprotein L, anticorps HNRNPLL, anticorps Hnrnpll, anticorps HNRPLL, anticorps hnrnpll, anticorps LOC100160547, anticorps hnrll, anticorps LOC100542006, anticorps LOC100638467, anticorps LOC100647365, anticorps HNRNPL

Sujet: HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.

Poids moléculaire: 60 kDa (MW of target protein)