NOVA2 anticorps (N-Term)

N° du produit ABIN630042

Cet anticorps anti-NOVA2 Polyclonal Lapin (ABIN630042) détecte spécifiquement NOVA2 dans WB. L’anticorps est réactif avec des échantillons de Humain et Poisson zèbre (Danio rerio).

Aperçu rapide pour NOVA2 anticorps (N-Term) (ABIN630042)

Antigène: NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))

Reactivité: Humain, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOVA2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NOVA2 anticorps

Épitope: N-Term

Specificité: NOVA2 antibody was raised against the N terminal of NOVA2

Purification: Purified

Immunogène: NOVA2 antibody was raised using the N terminal of NOVA2 corresponding to a region with amino acids MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOVA2 Blocking Peptide, (ABIN5615033), is also available for use as a blocking control in assays to test for specificity of this NOVA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOVA2

Antigène: NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))

Autre désignation: NOVA2

Sujet: NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.

Poids moléculaire: 54 kDa (MW of target protein)