Splicing Factor 1 anticorps (N-Term)
-
- Antigène Voir toutes Splicing Factor 1 (SF1) Anticorps
- Splicing Factor 1 (SF1)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Splicing Factor 1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SF1 antibody was raised against the N terminal of SF1
- Purification
- Purified
- Immunogène
- SF1 antibody was raised using the N terminal of SF1 corresponding to a region with amino acids NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ
- Top Product
- Discover our top product SF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SF1 Blocking Peptide, catalog no. 33R-6645, is also available for use as a blocking control in assays to test for specificity of this SF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Splicing Factor 1 (SF1)
- Autre désignation
- SF1 (SF1 Produits)
- Synonymes
- anticorps BBP, anticorps D11S636, anticorps MBBP, anticorps ZCCHC25, anticorps ZFM1, anticorps ZNF162, anticorps BB094781, anticorps CW17R, anticorps MZFM, anticorps WBP4, anticorps Zfp162, anticorps CG5836, anticorps Dmel\\CG5836, anticorps cg5836, anticorps dSF1, anticorps p70, anticorps SF1, anticorps sf1, anticorps wu:fc09f06, anticorps znf162, anticorps MWD22.25, anticorps MWD22_25, anticorps SF-1, anticorps splicing factor 1, anticorps Splicing factor 1, anticorps splicing factor-like protein, anticorps nuclear receptor subfamily 5 group A member 1, anticorps splicing factor 1 S homeolog, anticorps SF1, anticorps Sf1, anticorps sf1, anticorps AT5G51300, anticorps NR5A1, anticorps sf1.S
- Sujet
- SF1 contains 1 KH domain and 1 CCHC-type zinc finger. It is necessary for the ATP-dependent first step of spliceosome assembly and binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. It may act as transcription repressor.
- Poids moléculaire
- 68 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Maintenance of Protein Location
-