APOO anticorps (C-Term)

N° du produit ABIN630052

Détail du produit anti-APOO anticorps

Antigène: APOO (Apolipoprotein O (APOO))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APOO est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM121 B antibody was raised against the C terminal Of Fam121

Purification: Purified

Immunogène: FAM121 B antibody was raised using the C terminal Of Fam121 corresponding to a region with amino acids LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM121B Blocking Peptide, catalog no. 33R-5578, is also available for use as a blocking control in assays to test for specificity of this FAM121B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APOO

Antigène: APOO (Apolipoprotein O (APOO))

Autre désignation: FAM121B (APOO Produits)

Synonymes: anticorps fam121b, anticorps fp74f12, anticorps wu:fp74f12, anticorps zgc:123314, anticorps my025, anticorps FAM121B, anticorps 0610008C08Rik, anticorps 1110019O03Rik, anticorps RGD1565289, anticorps MGC79016, anticorps si:rp71-1f1.3, anticorps wu:fr42a11, anticorps zgc:103766, anticorps apolipoprotein O, a, anticorps apolipoprotein O, anticorps apolipoprotein O L homeolog, anticorps apolipoprotein O, b, anticorps apooa, anticorps apoo, anticorps APOO, anticorps Apoo, anticorps apoo.L, anticorps apoob

Sujet: FAM121B belongs to the FAM121 family and the function remains unknown.

Poids moléculaire: 22 kDa (MW of target protein)