TMED4 anticorps (N-Term)

N° du produit ABIN630054

Cet anticorps anti-TMED4 est un anticorps Polyclonal produit chez le Lapin, détectant TMED4 dans WB et IHC. Convient pour Humain.

Aperçu rapide pour TMED4 anticorps (N-Term) (ABIN630054)

Antigène: TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMED4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-TMED4 anticorps

Épitope: N-Term

Specificité: TMED4 antibody was raised against the N terminal of TMED4

Purification: Purified

Immunogène: TMED4 antibody was raised using the N terminal of TMED4 corresponding to a region with amino acids LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMED4 Blocking Peptide, (ABIN5616652), is also available for use as a blocking control in assays to test for specificity of this TMED4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMED4

Antigène: TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))

Autre désignation: TMED4

Sujet: TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.

Poids moléculaire: 25 kDa (MW of target protein)