YARS anticorps (C-Term)

N° du produit ABIN630055

Cet anticorps Lapin Polyclonal détecte spécifiquement YARS dans WB. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour YARS anticorps (C-Term) (ABIN630055)

Antigène: YARS (Yars) (Tyrosyl-tRNA Synthetase (Yars))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp YARS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-YARS anticorps

Épitope: C-Term

Specificité: YARS antibody was raised against the C terminal of YARS

Purification: Purified

Immunogène: YARS antibody was raised using the C terminal of YARS corresponding to a region with amino acids QVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEE

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

YARS Blocking Peptide, (ABIN5617056), is also available for use as a blocking control in assays to test for specificity of this YARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur YARS

Antigène: YARS (Yars) (Tyrosyl-tRNA Synthetase (Yars))

Autre désignation: YARS

Sujet: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.

Poids moléculaire: 58 kDa (MW of target protein)