CLCN3 anticorps (C-Term)

N° du produit ABIN630057

Cet anticorps anti-CLCN3 est un anticorps Lapin Polyclonal détectant CLCN3 dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour CLCN3 anticorps (C-Term) (ABIN630057)

Antigène: CLCN3 (Chloride Channel 3 (CLCN3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLCN3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-CLCN3 anticorps

Épitope: C-Term

Specificité: CLCN3 antibody was raised against the C terminal of CLCN3

Purification: Purified

Immunogène: CLCN3 antibody was raised using the C terminal of CLCN3 corresponding to a region with amino acids MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLCN3 Blocking Peptide, (ABIN5612915), is also available for use as a blocking control in assays to test for specificity of this CLCN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLCN3

Antigène: CLCN3 (Chloride Channel 3 (CLCN3))

Autre désignation: CLCN3

Sujet: CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).

Poids moléculaire: 95 kDa (MW of target protein)