CLIC1 anticorps (C-Term)
-
- Antigène Voir toutes CLIC1 Anticorps
- CLIC1 (Chloride Intracellular Channel 1 (CLIC1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CLIC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CLIC1 antibody was raised against the C terminal of CLIC1
- Purification
- Purified
- Immunogène
- CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST
- Top Product
- Discover our top product CLIC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CLIC1 Blocking Peptide, catalog no. 33R-5478, is also available for use as a blocking control in assays to test for specificity of this CLIC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CLIC1 (Chloride Intracellular Channel 1 (CLIC1))
- Autre désignation
- CLIC1 (CLIC1 Produits)
- Synonymes
- anticorps ncc27, anticorps xclic1, anticorps MGC75951, anticorps MGC132377, anticorps CLIC1, anticorps G6, anticorps NCC27, anticorps Clcp, anticorps wu:fc30e04, anticorps zgc:77044, anticorps chloride intracellular channel 1, anticorps chloride intracellular channel 1 S homeolog, anticorps clic1, anticorps CLIC1, anticorps Clic1, anticorps clic1.S
- Sujet
- Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
- Poids moléculaire
- 27 kDa (MW of target protein)
-