CLIC1 anticorps (C-Term)

N° du produit ABIN630062

Détail du produit anti-CLIC1 anticorps

Antigène: CLIC1 (Chloride Intracellular Channel 1 (CLIC1))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLIC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CLIC1 antibody was raised against the C terminal of CLIC1

Purification: Purified

Immunogène: CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLIC1 Blocking Peptide, catalog no. 33R-5478, is also available for use as a blocking control in assays to test for specificity of this CLIC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLIC1

Antigène: CLIC1 (Chloride Intracellular Channel 1 (CLIC1))

Autre désignation: CLIC1 (CLIC1 Produits)

Synonymes: anticorps ncc27, anticorps xclic1, anticorps MGC75951, anticorps MGC132377, anticorps CLIC1, anticorps G6, anticorps NCC27, anticorps Clcp, anticorps wu:fc30e04, anticorps zgc:77044, anticorps chloride intracellular channel 1, anticorps chloride intracellular channel 1 S homeolog, anticorps clic1, anticorps CLIC1, anticorps Clic1, anticorps clic1.S

Sujet: Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Poids moléculaire: 27 kDa (MW of target protein)