CLIC5 anticorps (C-Term)

N° du produit ABIN630075

Cet anticorps anti-CLIC5 est un anticorps Lapin Polyclonal détectant CLIC5 dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour CLIC5 anticorps (C-Term) (ABIN630075)

Antigène: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLIC5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-CLIC5 anticorps

Épitope: C-Term

Specificité: CLIC5 antibody was raised against the C terminal of CLIC5

Purification: Purified

Immunogène: CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLIC5 Blocking Peptide, (ABIN936202), is also available for use as a blocking control in assays to test for specificity of this CLIC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLIC5

Antigène: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Autre désignation: CLIC5

Sujet: Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Sensory Perception of Sound