KCTD18 anticorps (N-Term)

N° du produit ABIN630077

L’anticorps Lapin Polyclonal anti-KCTD18 a été validé pour WB. Il convient pour détecter KCTD18 dans des échantillons de Humain.

Aperçu rapide pour KCTD18 anticorps (N-Term) (ABIN630077)

Antigène: KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCTD18 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KCTD18 anticorps

Épitope: N-Term

Specificité: KCTD18 antibody was raised against the N terminal of KCTD18

Purification: Purified

Immunogène: KCTD18 antibody was raised using the N terminal of KCTD18 corresponding to a region with amino acids LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCTD18 Blocking Peptide, (ABIN940421), is also available for use as a blocking control in assays to test for specificity of this KCTD18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCTD18

Antigène: KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))

Autre désignation: KCTD18

Sujet: The function of Anti-KCTD18 has not yet been determined.

Poids moléculaire: 47 kDa (MW of target protein)