KCTD6 anticorps (N-Term)

N° du produit ABIN630078

Détail du produit anti-KCTD6 anticorps

Antigène: KCTD6 (Potassium Channel Tetramerisation Domain Containing 6 (KCTD6))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCTD6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KCTD6 antibody was raised against the N terminal of KCTD6

Purification: Purified

Immunogène: KCTD6 antibody was raised using the N terminal of KCTD6 corresponding to a region with amino acids HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCTD6 Blocking Peptide, catalog no. 33R-3794, is also available for use as a blocking control in assays to test for specificity of this KCTD6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCTD6

Antigène: KCTD6 (Potassium Channel Tetramerisation Domain Containing 6 (KCTD6))

Autre désignation: KCTD6 (KCTD6 Produits)

Synonymes: anticorps KCTD6, anticorps 5430433B02Rik, anticorps AU044285, anticorps kctd6, anticorps zgc:91884, anticorps KCASH3, anticorps potassium channel tetramerization domain containing 6, anticorps potassium channel tetramerisation domain containing 6, anticorps potassium channel tetramerization domain containing 6b, anticorps KCTD6, anticorps kctd6, anticorps Kctd6, anticorps kctd6b

Sujet: KCTD6 is a domain of potassium channel.

Poids moléculaire: 28 kDa (MW of target protein)