ACCN5 anticorps (Middle Region)

N° du produit ABIN630083

Détail du produit anti-ACCN5 anticorps

Antigène: ACCN5 (Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACCN5 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACCN5 antibody was raised against the middle region of ACCN5

Purification: Purified

Immunogène: ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACCN5 Blocking Peptide, catalog no. 33R-3090, is also available for use as a blocking control in assays to test for specificity of this ACCN5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACCN5

Antigène: ACCN5 (Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5))

Autre désignation: ACCN5 (ACCN5 Produits)

Synonymes: anticorps ACCN5, anticorps HINAC, anticorps INAC, anticorps Accn5, anticorps Blinac, anticorps Inac, anticorps acid sensing ion channel subunit family member 5, anticorps acid-sensing (proton-gated) ion channel family member 5, anticorps ASIC5, anticorps asic5, anticorps Asic5

Sujet: ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.

Poids moléculaire: 56 kDa (MW of target protein)