GABRA3 anticorps

N° du produit ABIN630101

Détail du produit anti-GABRA3 anticorps

Antigène: GABRA3 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABRA3 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: GABRA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABRA3 Blocking Peptide, catalog no. 33R-1156, is also available for use as a blocking control in assays to test for specificity of this GABRA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABRA3

Antigène: GABRA3 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3))

Autre désignation: GABRA3 (GABRA3 Produits)

Synonymes: anticorps GABRA3, anticorps Gabra-3, anticorps si:ch211-113k9.1, anticorps gamma-aminobutyric acid type A receptor alpha3 subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, alpha 3, anticorps gamma-aminobutyric acid (GABA) A receptor, subunit alpha 3, anticorps gamma-aminobutyric acid receptor subunit alpha-3, anticorps GABRA3, anticorps gabra3, anticorps Gabra3, anticorps LOC100653496

Sujet: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Poids moléculaire: 55 kDa (MW of target protein)