KCNK3 anticorps (C-Term)

N° du produit ABIN630109

Détail du produit anti-KCNK3 anticorps

Antigène: KCNK3 (Potassium Channel, Subfamily K, Member 3 (KCNK3))

Épitope: C-Term

Reactivité: Rat, Souris, Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK3 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNK3 antibody was raised against the C terminal of KCNK3

Purification: Purified

Immunogène: KCNK3 antibody was raised using the C terminal of KCNK3 corresponding to a region with amino acids TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK3 Blocking Peptide, catalog no. 33R-9002, is also available for use as a blocking control in assays to test for specificity of this KCNK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK3

Antigène: KCNK3 (Potassium Channel, Subfamily K, Member 3 (KCNK3))

Autre désignation: KCNK3 (KCNK3 Produits)

Synonymes: anticorps si:dkey-164m15.1, anticorps K2p3.1, anticorps OAT1, anticorps PPH4, anticorps TASK, anticorps TASK-1, anticorps TBAK1, anticorps cTBAK-1, anticorps Task-1, anticorps rTASK, anticorps KCNK3, anticorps potassium channel, subfamily K, member 3a, anticorps potassium two pore domain channel subfamily K member 3, anticorps potassium channel, subfamily K, member 3, anticorps kcnk3a, anticorps KCNK3, anticorps Kcnk3

Sujet: KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.

Poids moléculaire: 43 kDa (MW of target protein)