SOD1 anticorps (N-Term)

N° du produit ABIN630121

Cet anticorps Lapin Polyclonal détecte spécifiquement SOD1 dans WB et IHC. Il présente une réactivité envers Humain.

Aperçu rapide pour SOD1 anticorps (N-Term) (ABIN630121)

Antigène: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SOD1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SOD1 anticorps

Épitope: N-Term

Specificité: SOD1 antibody was raised against the N terminal of SOD1

Purification: Purified

Immunogène: SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SOD1 Blocking Peptide, (ABIN5616333), is also available for use as a blocking control in assays to test for specificity of this SOD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SOD1

Antigène: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Autre désignation: SOD1

Sujet: SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis