SOD1 anticorps (N-Term)

N° du produit ABIN630121

Détail du produit anti-SOD1 anticorps

Antigène: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SOD1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SOD1 antibody was raised against the N terminal of SOD1

Purification: Purified

Immunogène: SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SOD1 Blocking Peptide, catalog no. 33R-5777, is also available for use as a blocking control in assays to test for specificity of this SOD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SOD1

Antigène: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Autre désignation: SOD1 (SOD1 Produits)

Synonymes: anticorps LOC692639, anticorps ALS, anticorps ALS1, anticorps IPOA, anticorps SOD, anticorps hSod1, anticorps homodimer, anticorps CG11793, anticorps Cu, anticorps Cu-Zn SOD, anticorps Cu/Zn SOD, anticorps Cu/Zn sod, anticorps Cu/Zn superoxide dismutase, anticorps Cu/ZnSOD, anticorps CuSOD, anticorps CuZn SOD, anticorps CuZn-SOD, anticorps CuZn-SOD1, anticorps CuZnSOD, anticorps Cu[2+]/Zn[2+]SOD, anticorps Dmel\\CG11793, anticorps G, anticorps Mn SOD, anticorps SOD-1, anticorps SOD1, anticorps Sod-1, anticorps Sod1, anticorps To, anticorps To-1, anticorps Zn SOD, anticorps Zn Sod, anticorps Zn-SOD, anticorps ZnSod, anticorps cSOD, anticorps cSod, anticorps dSOD1, anticorps l(3)108, anticorps l(3)68Af', anticorps l(3)G, anticorps sod, anticorps sod1, anticorps CU/ZN-SOD, anticorps SODC, anticorps DKFZP469M1833, anticorps B430204E11Rik, anticorps Cu/Zn-SOD, anticorps Ipo-1, anticorps Ipo1, anticorps SOD1L1, anticorps XSODB, anticorps als, anticorps als1, anticorps ipoa, anticorps sod1-a, anticorps ZSOD, anticorps cuzn, anticorps Cu/Zn superoxide dismutase, anticorps superoxide dismutase 1, anticorps Superoxide dismutase 1, anticorps superoxide dismutase 1, soluble, anticorps superoxide dismutase 1 S homeolog, anticorps Superoxide dismutase [Cu-Zn], anticorps superoxide dismutase 1 L homeolog, anticorps superoxide dismutase [Cu-Zn]-like, anticorps superoxide dismutase [Cu-Zn], anticorps superoxide dismutase Sod1, anticorps SOD, anticorps SOD1, anticorps Sod1, anticorps sod1, anticorps sod1.S, anticorps sod-1, anticorps sod1.L, anticorps LOC101451855, anticorps LOC101115136

Sujet: SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis