FABP7 anticorps (N-Term)

N° du produit ABIN630122

Détail du produit anti-FABP7 anticorps

Antigène: FABP7 (Fatty Acid Binding Protein 7, Brain (FABP7))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FABP7 est non-conjugé

Application: Western Blotting (WB)

Specificité: FABP7 antibody was raised against the N terminal of FABP7

Purification: Purified

Immunogène: FABP7 antibody was raised using the N terminal of FABP7 corresponding to a region with amino acids NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FABP7 Blocking Peptide, catalog no. 33R-6680, is also available for use as a blocking control in assays to test for specificity of this FABP7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FABP7

Antigène: FABP7 (Fatty Acid Binding Protein 7, Brain (FABP7))

Autre désignation: FABP7 (FABP7 Produits)

Synonymes: anticorps B-FABP, anticorps FABP7, anticorps D168, anticorps fabp7, anticorps wu:fb62f07, anticorps wu:fq20b08, anticorps BLBP, anticorps FABPB, anticorps MRG, anticorps BFABP, anticorps Blbp, anticorps fatty acid binding protein 7, anticorps fatty acid binding protein 7, brain, a, anticorps fatty acid-binding protein, brain, anticorps fatty acid binding protein 7, brain, anticorps fatty acid binding protein 7, brain L homeolog, anticorps fatty acid binding protein 7, brain, b, anticorps FABP7, anticorps Fabp7, anticorps fabp7a, anticorps fabp7, anticorps fabp7.L, anticorps fabp7b

Sujet: The protein encoded by FABP7 is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism.

Poids moléculaire: 15 kDa (MW of target protein)