MBNL1 anticorps
-
- Antigène Voir toutes MBNL1 Anticorps
- MBNL1 (Muscleblind-like Protein 1 (MBNL1))
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MBNL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA
- Top Product
- Discover our top product MBNL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MBNL1 Blocking Peptide, catalog no. 33R-4829, is also available for use as a blocking control in assays to test for specificity of this MBNL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBNL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MBNL1 (Muscleblind-like Protein 1 (MBNL1))
- Autre désignation
- MBNL1 (MBNL1 Produits)
- Synonymes
- anticorps MBNL1, anticorps zgc:153954, anticorps Mbnl, anticorps mKIAA0428, anticorps EXP, anticorps EXP35, anticorps EXP40, anticorps EXP42, anticorps MBNL, anticorps muscleblind like splicing regulator 1, anticorps muscleblind-like splicing regulator 1, anticorps muscleblind like splicing factor 1, anticorps MBNL1, anticorps mbnl1, anticorps Mbnl1
- Sujet
- MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.
- Poids moléculaire
- 37 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-