FGA anticorps (N-Term)

N° du produit ABIN630126

Cité dans 1 publication. Cet anticorps anti-FGA Polyclonal Lapin (ABIN630126) détecte spécifiquement FGA dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour FGA anticorps (N-Term) (ABIN630126)

Antigène: FGA (Fibrinogen alpha Chain (FGA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FGA est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-FGA anticorps

Épitope: N-Term

Specificité: Fibrinogen Alpha antibody was raised against the N terminal of FGA

Purification: Purified

Immunogène: Fibrinogen Alpha antibody was raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Fibrinogen Alpha Blocking Peptide, (ABIN5613586), is also available for use as a blocking control in assays to test for specificity of this Fibrinogen Alpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-FGA (ABIN630126)

Matsumoto, Matsuura, Aoki, Maehashi, Iwamoto, Ohkawa, Yoshida, Yanaga, Takada: "An efficient system for secretory production of fibrinogen using a hepatocellular carcinoma cell line." dans: Hepatology research : the official journal of the Japan Society of Hepatology, Vol. 45, Issue 3, pp. 315-25, (2016) (PubMed).

Détails sur FGA

Antigène: FGA (Fibrinogen alpha Chain (FGA))

Autre désignation: Fibrinogen alpha

Sujet: FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.

Poids moléculaire: 71 kDa (MW of target protein)