DNASE2B anticorps (C-Term)

N° du produit ABIN630127

Détail du produit anti-DNASE2B anticorps

Antigène: DNASE2B (Deoxyribonuclease II beta (DNASE2B))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNASE2B est non-conjugé

Application: Western Blotting (WB)

Specificité: DNASE2 B antibody was raised against the C terminal of DNASE2

Purification: Purified

Immunogène: DNASE2 B antibody was raised using the C terminal of DNASE2 corresponding to a region with amino acids MAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQD

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNASE2B Blocking Peptide, catalog no. 33R-5727, is also available for use as a blocking control in assays to test for specificity of this DNASE2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNASE2B

Antigène: DNASE2B (Deoxyribonuclease II beta (DNASE2B))

Autre désignation: DNASE2B (DNASE2B Produits)

Synonymes: anticorps DNASE2, anticorps deoxyribonuclease-2-beta, anticorps DLAD, anticorps DNASE2B, anticorps dnase2b, anticorps AI526873, anticorps Dlad, anticorps DnaseIIb, anticorps UOX, anticorps deoxyribonuclease 2 beta, anticorps deoxyribonuclease II beta, anticorps DNASE2B, anticorps dnase2b, anticorps Dnase2b

Sujet: DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs.

Poids moléculaire: 17 kDa (MW of target protein)