PCMT1 anticorps

N° du produit ABIN630131

L’anticorps anti-PCMT1 Polyclonal Lapin est utilisé pour la détection de PCMT1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour PCMT1 anticorps (ABIN630131)

Antigène: PCMT1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCMT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PCMT1 anticorps

Purification: Purified

Immunogène: PCMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCMT1 Blocking Peptide, (ABIN936828), is also available for use as a blocking control in assays to test for specificity of this PCMT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCMT1

Antigène: PCMT1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1))

Autre désignation: PCMT1

Sujet: Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization