GOT2 anticorps

N° du produit ABIN630134

Détail du produit anti-GOT2 anticorps

Antigène: GOT2 (Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GOT2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GOT2 Blocking Peptide, catalog no. 33R-7247, is also available for use as a blocking control in assays to test for specificity of this GOT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GOT2

Antigène: GOT2 (Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2))

Autre désignation: GOT2 (GOT2 Produits)

Synonymes: anticorps KAT4, anticorps KATIV, anticorps mitAAT, anticorps AI789014, anticorps Got-1, anticorps cAspAT, anticorps cCAT, anticorps AL022787, anticorps FABP-pm, anticorps Got-2, anticorps mAspAT, anticorps ASPATA, anticorps got2, anticorps zgc:66329, anticorps fj40h07, anticorps wu:fj40h07, anticorps zgc:56425, anticorps glutamic-oxaloacetic transaminase 2, anticorps glutamic-oxaloacetic transaminase 1, soluble, anticorps glutamatic-oxaloacetic transaminase 2, mitochondrial, anticorps glutamic-oxaloacetic transaminase 2a, mitochondrial, anticorps glutamic-oxaloacetic transaminase 2 L homeolog, anticorps Aspartate amino transferase activity, anticorps glutamic-oxaloacetic transaminase 2b, mitochondrial, anticorps GOT2, anticorps got2, anticorps Got1, anticorps Got2, anticorps got2a, anticorps got2.L, anticorps AST, anticorps got2b

Sujet: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process