LNX1 anticorps (C-Term)

N° du produit ABIN630139

Détail du produit anti-LNX1 anticorps

Antigène: LNX1 (Ligand of Numb-Protein X 1 (LNX1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LNX1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LNX1 antibody was raised against the C terminal of LNX1

Purification: Purified

Immunogène: LNX1 antibody was raised using the C terminal of LNX1 corresponding to a region with amino acids SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LNX1 Blocking Peptide, catalog no. 33R-8514, is also available for use as a blocking control in assays to test for specificity of this LNX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LNX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LNX1

Antigène: LNX1 (Ligand of Numb-Protein X 1 (LNX1))

Autre désignation: LNX1 (LNX1 Produits)

Synonymes: anticorps LNX1, anticorps fj78f06, anticorps lnx, anticorps si:dkey-12h2.1, anticorps wu:fj78f06, anticorps zgc:152906, anticorps Lnx, anticorps LNX, anticorps MPDZ, anticorps PDZRN2, anticorps ligand of numb-protein X 1, anticorps LNX1, anticorps lnx1, anticorps Lnx1

Sujet: LNX1 is a membrane-bound protein that is involved in signal transduction and protein interactions. LNX1 is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis.

Poids moléculaire: 70 kDa (MW of target protein)