NUCB2 anticorps (Middle Region)

N° du produit ABIN630150

Détail du produit anti-NUCB2 anticorps

Antigène: NUCB2 (Nucleobindin 2 (NUCB2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUCB2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Nucleobindin 2 antibody was raised against the middle region of NUCB2

Purification: Purified

Immunogène: Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Nucleobindin 2 Blocking Peptide, catalog no. 33R-6232, is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUCB2

Antigène: NUCB2 (Nucleobindin 2 (NUCB2))

Autre désignation: Nucleobindin 2 (NUCB2 Produits)

Synonymes: anticorps nefa, anticorps MGC97715, anticorps NUCB2, anticorps nucleobindin-2, anticorps NEFA, anticorps AI607786, anticorps Calnuc, anticorps Nefa, anticorps Nesfatin-1, anticorps p54, anticorps nucleobindin 2, anticorps nucleobindin 2 L homeolog, anticorps nucb2, anticorps NUCB2, anticorps Nucb2, anticorps nucb2.L

Sujet: Nucleobindin-2 is a calcium-binding EF-hand protein.

Poids moléculaire: 46 kDa (MW of target protein)