A1BG anticorps (N-Term)

N° du produit ABIN630152

L’anticorps Lapin Polyclonal anti-A1BG a été validé pour WB. Il convient pour détecter A1BG dans des échantillons de Humain.

Aperçu rapide pour A1BG anticorps (N-Term) (ABIN630152)

Antigène: A1BG (alpha-1-B Glycoprotein (A1BG))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp A1BG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-A1BG anticorps

Épitope: N-Term

Specificité: A1 BG antibody was raised against the N terminal of A1 G

Purification: Purified

Immunogène: A1 BG antibody was raised using the N terminal of A1 G corresponding to a region with amino acids ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

A1BG Blocking Peptide, (ABIN939570), is also available for use as a blocking control in assays to test for specificity of this A1BG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 G antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur A1BG

Antigène: A1BG (alpha-1-B Glycoprotein (A1BG))

Autre désignation: A1BG

Sujet: A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.

Poids moléculaire: 52 kDa (MW of target protein)