Nucleobindin 1 anticorps (C-Term)

N° du produit ABIN630154

Cet anticorps Lapin Polyclonal détecte spécifiquement Nucleobindin 1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour Nucleobindin 1 anticorps (C-Term) (ABIN630154)

Antigène: Nucleobindin 1 (NUCB1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nucleobindin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Nucleobindin 1 anticorps

Épitope: C-Term

Specificité: Nucleobindin 1 antibody was raised against the C terminal of NUCB1

Purification: Purified

Immunogène: Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nucleobindin 1

Antigène: Nucleobindin 1 (NUCB1)

Autre désignation: Nucleobindin 1

Sujet: Calnuc or NUCB1 belongs to the nucleobindin family. It is a major calcium-binding protein of the Golgi and is a good Golgi marker. It may be involved in calcium homeostasis. Calnuc also plays roles in regulation of levels of amyloid precursor protein (APP) and its proteolytic metabolites to further affect the patho/physiological functions of APP including Alzheimer's disease pathogenesis.

Poids moléculaire: 51 kDa (MW of target protein)