Follistatin anticorps (C-Term)

N° du produit ABIN630158

L’anticorps Lapin Polyclonal anti-Follistatin a été validé pour WB. Il convient pour détecter Follistatin dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour Follistatin anticorps (C-Term) (ABIN630158)

Antigène: Follistatin (FST)

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Follistatin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Follistatin anticorps

Épitope: C-Term

Specificité: FST antibody was raised against the C terminal of FST

Purification: Purified

Immunogène: FST antibody was raised using the C terminal of FST corresponding to a region with amino acids SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FST Blocking Peptide, (ABIN5613644), is also available for use as a blocking control in assays to test for specificity of this FST antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Follistatin

Antigène: Follistatin (FST)

Autre désignation: FST

Sujet: Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion