HMGCL anticorps

N° du produit ABIN630162

Cet anticorps anti-HMGCL est un anticorps Lapin Polyclonal détectant HMGCL dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour HMGCL anticorps (ABIN630162)

Antigène: HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMGCL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HMGCL anticorps

Purification: Purified

Immunogène: HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HMGCL Blocking Peptide, (ABIN935989), is also available for use as a blocking control in assays to test for specificity of this HMGCL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HMGCL

Antigène: HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))

Autre désignation: HMGCL

Sujet: The deficiency of HMGCL is related to an autosomal recessive branched chain organic aciduria.

Poids moléculaire: 36 kDa (MW of target protein)