PNLIP anticorps (C-Term)

N° du produit ABIN630164

L’anticorps Lapin Polyclonal anti-PNLIP a été validé pour WB et IHC. Il convient pour détecter PNLIP dans des échantillons de Humain.

Aperçu rapide pour PNLIP anticorps (C-Term) (ABIN630164)

Antigène: PNLIP (Pancreatic Lipase (PNLIP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNLIP est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PNLIP anticorps

Épitope: C-Term

Specificité: Lipase antibody (Pancreatic) was raised against the C terminal of PNLIP

Purification: Purified

Immunogène: Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lipase Blocking Peptide (Pancreatic), (ABIN938706), is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Pancreatic)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNLIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNLIP

Antigène: PNLIP (Pancreatic Lipase (PNLIP))

Autre désignation: Pancreatic Lipase

Sujet: PNLIP is a member of the lipase gene family. PNLIP is a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. It is expressed specifically in the pancreas.

Poids moléculaire: 51 kDa (MW of target protein)