Asporin anticorps (Middle Region)

N° du produit ABIN630167

L’anticorps Lapin Polyclonal anti-Asporin a été validé pour WB et IHC. Il convient pour détecter Asporin dans des échantillons de Humain et Rat.

Aperçu rapide pour Asporin anticorps (Middle Region) (ABIN630167)

Antigène: Asporin (ASPN)

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Asporin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Asporin anticorps

Épitope: Middle Region

Specificité: Asporin antibody was raised against the middle region of ASPN

Purification: Purified

Immunogène: Asporin antibody was raised using the middle region of ASPN corresponding to a region with amino acids NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Asporin Blocking Peptide, (ABIN5612193), is also available for use as a blocking control in assays to test for specificity of this Asporin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Asporin

Antigène: Asporin (ASPN)

Autre désignation: Asporin

Sujet: ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.

Poids moléculaire: 42 kDa (MW of target protein)