GZMH anticorps

N° du produit ABIN630169

Détail du produit anti-GZMH anticorps

Antigène: GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GZMH est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: Granzyme H antibody was raised using a synthetic peptide corresponding to a region with amino acids MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Granzyme H Blocking Peptide, catalog no. 33R-6337, is also available for use as a blocking control in assays to test for specificity of this Granzyme H antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GZMH

Antigène: GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))

Autre désignation: Granzyme H (GZMH Produits)

Synonymes: anticorps GZMH, anticorps CCP-X, anticorps CGL-2, anticorps CSP-C, anticorps CTLA1, anticorps CTSGL2, anticorps granzyme H, anticorps LOC617313, anticorps GZMH

Sujet: This enzyme is probably necessary for target cell lysis in cell-mediated immune responses.

Poids moléculaire: 27 kDa (MW of target protein)