MCM8 anticorps (N-Term)

N° du produit ABIN630180

Cet anticorps anti-MCM8 est un anticorps Lapin Polyclonal détectant MCM8 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour MCM8 anticorps (N-Term) (ABIN630180)

Antigène: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MCM8 anticorps

Épitope: N-Term

Specificité: MCM8 antibody was raised against the N terminal of MCM8

Purification: Purified

Immunogène: MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH

Information d'application

Indications d'application: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM8 Blocking Peptide, (ABIN937955), is also available for use as a blocking control in assays to test for specificity of this MCM8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM8

Antigène: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Autre désignation: MCM8

Sujet: MCM8 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Poids moléculaire: 92 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA