RRM1 anticorps (N-Term)

N° du produit ABIN630191

L’anticorps Lapin Polyclonal anti-RRM1 a été validé pour WB. Il convient pour détecter RRM1 dans des échantillons de Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien et C. elegans.

Aperçu rapide pour RRM1 anticorps (N-Term) (ABIN630191)

Antigène: RRM1 (Ribonucleotide Reductase M1 (RRM1))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RRM1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RRM1 anticorps

Épitope: N-Term

Specificité: RRM1 antibody was raised against the N terminal of RRM1

Purification: Purified

Immunogène: RRM1 antibody was raised using the N terminal of RRM1 corresponding to a region with amino acids ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RRM1 Blocking Peptide, (ABIN936944), is also available for use as a blocking control in assays to test for specificity of this RRM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RRM1

Antigène: RRM1 (Ribonucleotide Reductase M1 (RRM1))

Autre désignation: RRM1

Sujet: RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. Its gene is located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. Its gene may play a role in malignancies and disease that involve this region.

Poids moléculaire: 90 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity