IRF6 anticorps (C-Term)

N° du produit ABIN630193

Cet anticorps Lapin Polyclonal détecte spécifiquement IRF6 dans WB. Il présente une réactivité envers Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour IRF6 anticorps (C-Term) (ABIN630193)

Antigène: IRF6 (Interferon Regulatory Factor 6 (IRF6))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IRF6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IRF6 anticorps

Épitope: C-Term

Specificité: IRF6 antibody was raised against the C terminal of IRF6

Purification: Purified

Immunogène: IRF6 antibody was raised using the C terminal of IRF6 corresponding to a region with amino acids FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IRF6 Blocking Peptide, (ABIN938372), is also available for use as a blocking control in assays to test for specificity of this IRF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IRF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IRF6

Antigène: IRF6 (Interferon Regulatory Factor 6 (IRF6))

Autre désignation: IRF6

Sujet: IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.

Poids moléculaire: 65 kDa (MW of target protein)