IRF6 anticorps (C-Term)

N° du produit ABIN630193

Détail du produit anti-IRF6 anticorps

Antigène: IRF6 (Interferon Regulatory Factor 6 (IRF6))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IRF6 est non-conjugé

Application: Western Blotting (WB)

Specificité: IRF6 antibody was raised against the C terminal of IRF6

Purification: Purified

Immunogène: IRF6 antibody was raised using the C terminal of IRF6 corresponding to a region with amino acids FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IRF6 Blocking Peptide, catalog no. 33R-2986, is also available for use as a blocking control in assays to test for specificity of this IRF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IRF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IRF6

Antigène: IRF6 (Interferon Regulatory Factor 6 (IRF6))

Autre désignation: IRF6 (IRF6 Produits)

Synonymes: anticorps IRF6, anticorps lps, anticorps pit, anticorps pps, anticorps vws, anticorps ofc6, anticorps xIRF-6, anticorps DKFZp469E012, anticorps LPS, anticorps OFC6, anticorps PIT, anticorps PPS, anticorps PPS1, anticorps VWS, anticorps VWS1, anticorps zgc:63500, anticorps AI876454, anticorps E230028I05Rik, anticorps mirf6, anticorps interferon regulatory factor 6, anticorps interferon regulatory factor 6 S homeolog, anticorps IRF6, anticorps irf6, anticorps irf6.S, anticorps Irf6

Sujet: IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.

Poids moléculaire: 65 kDa (MW of target protein)