RBMS1 anticorps (C-Term)

N° du produit ABIN630197

L’anticorps anti-RBMS1 Polyclonal Lapin est utilisé pour la détection de RBMS1 dans des échantillons de Humain, Souris et Chien. Il a été validé pour WB et IHC.

Aperçu rapide pour RBMS1 anticorps (C-Term) (ABIN630197)

Antigène: RBMS1 (RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBMS1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RBMS1 anticorps

Épitope: C-Term

Specificité: RBMS1 antibody was raised against the C terminal of RBMS1

Purification: Purified

Immunogène: RBMS1 antibody was raised using the C terminal of RBMS1 corresponding to a region with amino acids TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBMS1 Blocking Peptide, (ABIN5615801), is also available for use as a blocking control in assays to test for specificity of this RBMS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBMS1

Antigène: RBMS1 (RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1))

Autre désignation: RBMS1

Sujet: RBMS1 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.

Poids moléculaire: 44 kDa (MW of target protein)