Cullin 5 anticorps (C-Term)

N° du produit ABIN630202

Détail du produit anti-Cullin 5 anticorps

Antigène: Cullin 5 (CUL5)

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cullin 5 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cullin 5 antibody was raised against the C terminal of CUL5

Purification: Purified

Immunogène: Cullin 5 antibody was raised using the C terminal of CUL5 corresponding to a region with amino acids VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cullin 5 Blocking Peptide, catalog no. 33R-9706, is also available for use as a blocking control in assays to test for specificity of this Cullin 5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cullin 5

Antigène: Cullin 5 (CUL5)

Autre désignation: Cullin 5 (CUL5 Produits)

Synonymes: anticorps cul5, anticorps wu:fd17d09, anticorps wu:fi20h12, anticorps xx:11fd17d09, anticorps zgc:66185, anticorps Xcullin5, anticorps CG1401, anticorps CUL5, anticorps Cul5, anticorps Cullin 5, anticorps Cullin5, anticorps Dmel\\CG1401, anticorps cul-5, anticorps vacm-1, anticorps vacm1, anticorps VACM-1, anticorps VACM1, anticorps 4921514I20Rik, anticorps 8430423K24Rik, anticorps AI852817, anticorps C030032G03Rik, anticorps C330021I08Rik, anticorps Cullin-5, anticorps cullin 5a, anticorps cullin 5 L homeolog, anticorps Cullin 5, anticorps cullin 5, anticorps Cullin-5, anticorps cul5a, anticorps cul5.L, anticorps Cul5, anticorps CUL5, anticorps cul5, anticorps cul-5

Sujet: CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.

Poids moléculaire: 86 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development