GNB1L anticorps

N° du produit ABIN630215

L’anticorps anti-GNB1L Polyclonal Lapin est utilisé pour la détection de GNB1L dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB et IHC.

Aperçu rapide pour GNB1L anticorps (ABIN630215)

Antigène: GNB1L (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNB1L est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-GNB1L anticorps

Purification: Purified

Immunogène: GNB1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNB1L Blocking Peptide, (ABIN5613811), is also available for use as a blocking control in assays to test for specificity of this GNB1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNB1L

Antigène: GNB1L (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L))

Autre désignation: GNB1L

Sujet: GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. Therefore, this gene may contribute to the etiology of those disorders.

Poids moléculaire: 36 kDa (MW of target protein)