NSMCE1 anticorps

N° du produit ABIN630218

L’anticorps Lapin Polyclonal anti-NSMCE1 a été validé pour WB. Il convient pour détecter NSMCE1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour NSMCE1 anticorps (ABIN630218)

Antigène: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NSMCE1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NSMCE1 anticorps

Purification: Purified

Immunogène: NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NSMCE1 Blocking Peptide, (ABIN5615067), is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSMCE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NSMCE1

Antigène: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Autre désignation: NSMCE1

Sujet: NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus